PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G224500.1
Common NamePOPTR_0001s23170g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 565aa    MW: 61837.1 Da    PI: 6.2698
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G224500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-175198148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT  Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Potri.001G224500.1 51 KGPWTSAEDAILIDYVKKHGEGNWNSVQKHSGLFRCGKSCRLRWANHL 98
                        79******************************************9986 PP

2Myb_DNA-binding26.31.8e-08104136135
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgR 35 
                         +g++T+eE+ +++++++ +G++ W++ a+++g ++
  Potri.001G224500.1 104 KGSFTPEEENRIIELHANMGNK-WARMAAEVG-NL 136
                         799*******************.********9.76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.23946102IPR017930Myb domain
SMARTSM007172.9E-1550100IPR001005SANT/Myb domain
SuperFamilySSF466892.57E-2452128IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-2452105IPR009057Homeodomain-like
CDDcd001676.58E-125398No hitNo description
PfamPF139211.2E-1554114No hitNo description
PROSITE profilePS512948.354103188IPR017930Myb domain
SMARTSM007171.0E-8103186IPR001005SANT/Myb domain
SuperFamilySSF466893.3E-6104184IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-21106135IPR009057Homeodomain-like
CDDcd001673.05E-5106182No hitNo description
Gene3DG3DSA:1.10.10.605.9E-21171186IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MCGRVLWHIH EMSSMMNGTE DNKRSKGRQD SPAADEVNDG GMVGGITPLK KGPWTSAEDA  60
ILIDYVKKHG EGNWNSVQKH SGLFRCGKSC RLRWANHLRP DLKKGSFTPE EENRIIELHA  120
NMGNKWARMA AEVGNLIPDL KCVRIHNVVW EEEIGRRGEI GSSGEKKLPG RTDNEIKNYW  180
NTRTKRLQRA GLPLYPPEVC LRAYKMNKDG QNMGKLQTGD AHDPDMMLTD HFKIPEVEFK  240
TLALNPGVLS YSTGLFDASA SSMLKQGVGS SYGQGLVFPT IHPAKRFRES QTIFTGLDGS  300
VSGGIPEFDQ FTDYHRGKIT GNFGLSSPYG CDLSNYDQSS CGVLPGSHAI LNGNSSSSSS  360
SEPIYRATKL ELPSLQYSET QQDSWGTPAS PLPSLESVDT FIQSPPTKET KSDGLSPRSS  420
GLLEAVLYES RTLKYSKKCP GHQTSDAFVP IGCGVHSSPL NACAAEWELH ADLNSPSGHS  480
ASSLFSECTP ISGSSSDEQA YNVKPEPIDQ VLPYVEAREV LNQTDCNRPD VLLGSTWFAP  540
SNKYHNDQFF QTDDVAALLG GDQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25451861106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298147.20.0hypothetical protein POPTR_0001s23170g
TrEMBLB9GEM70.0B9GEM7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s23170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.14e-88myb domain protein 65